Recombinant Rat Magt1 protein, His/SUMO-tagged
Cat.No. : | Magt1-16R |
Product Overview : | Recombinant Rat Magt1(30-335 aa) fused with His/SUMO tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 30-335 aa |
Description : | Magt1 played an important role in many functions. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | QRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | Magt1 magnesium transporter 1 [ Rattus norvegicus ] |
Official Symbol | Magt1 |
Synonyms | MAGT1; magnesium transporter 1; magnesium transporter protein 1; IAP; implantation-associated protein; Iag2; |
Gene ID | 116967 |
mRNA Refseq | NM_053946 |
Protein Refseq | NP_446398 |
UniProt ID | O35777 |
Chromosome Location | Xq22 |
Function | magnesium ion transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SOX2-608H | Recombinant Human SOX2 Protein, His-tagged | +Inquiry |
UGT2A4-7714Z | Recombinant Zebrafish UGT2A4 | +Inquiry |
NME2-10739M | Recombinant Mouse NME2 Protein | +Inquiry |
S100A8-1804R | Recombinant Rabbit S100A8 protein, His & T7-tagged | +Inquiry |
CLEC4C-269H | Active Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
RBP-246H | Native Human Retinol Binding Protein | +Inquiry |
Laminin-01H | Native Human Laminin Protein | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry |
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
CD3D & CD3E-944HCL | Recombinant Human CD3D & CD3E cell lysate | +Inquiry |
LUC7L2-4606HCL | Recombinant Human LUC7L2 293 Cell Lysate | +Inquiry |
KRT24-4872HCL | Recombinant Human KRT24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Magt1 Products
Required fields are marked with *
My Review for All Magt1 Products
Required fields are marked with *
0
Inquiry Basket