Recombinant Rat MADCAM1 Protein (20-353 aa), His-SUMO-tagged
Cat.No. : | MADCAM1-1928R |
Product Overview : | Recombinant Rat MADCAM1 Protein (20-353 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-353 aa |
Description : | Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 52.0 kDa |
AA Sequence : | QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Madcam1 mucosal vascular addressin cell adhesion molecule 1 [ Rattus norvegicus ] |
Official Symbol | MADCAM1 |
Synonyms | MADCAM1; MAdCAM-1; rMAdCAM-1; |
Gene ID | 54266 |
mRNA Refseq | NM_019317 |
Protein Refseq | NP_062190 |
UniProt ID | O70540 |
◆ Recombinant Proteins | ||
MADCAM1-3983HB | Biotinylated Recombinant Human mucosal vascular addressin cell adhesion molecule 1 Protein, Fc tagged | +Inquiry |
MADCAM1-3982H | Recombinant Human MADCAM1 protein, His-tagged | +Inquiry |
MAdCAM1-2179H | Active Recombinant Human MAdCAM1 protein, Fc-tagged | +Inquiry |
Madcam1-4509M | Recombinant Mouse Madcam1 protein, His-SUMO-tagged | +Inquiry |
MADCAM1-2538H | Recombinant Human MADCAM1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MADCAM1 Products
Required fields are marked with *
My Review for All MADCAM1 Products
Required fields are marked with *
0
Inquiry Basket