Recombinant Rat Kcnj10 Full Length Transmembrane protein, His-tagged

Cat.No. : Kcnj10-6271R
Product Overview : Recombinant Rat Kcnj10 protein(P49655)(1-379aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : In vitro E. coli expression system
Species : Rat
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 46.6 kDa
Protein length : 1-379aa
AA Sequence : MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Kcnj10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Rattus norvegicus ]
Official Symbol Kcnj10
Synonyms KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; BIR10; BIRK1; kir4.1; inward rectifier K(+) channel Kir4.1; brain-specific inwardly rectifying K(+) channel 1; ATP-sensitive inward rectifier potassium channel KAB-2; potassium channel, inwardly rectifying subfamily J member 10;
Gene ID 29718
mRNA Refseq NM_031602
Protein Refseq NP_113790

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Kcnj10 Products

Required fields are marked with *

My Review for All Kcnj10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon