Recombinant Rat IL17F Protein

• Cat.No.: IL17F-145R
• Product Overview: Recombinant Rat IL17F Protein without tag was expressed in E. coli.

Specification

• Description: Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes.
• Source: E. coli
• Species: Rat
• Bio-activity: No biological activity data is available at this time.
• AA Sequence: MARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Il17f interleukin 17F [ Rattus norvegicus (Norway rat) ]
• Official Symbol: IL17F
• Synonyms: IL17F; interleukin 17F; interleukin-17F; IL-17F; MGC114402
• Gene ID: 301291
• mRNA Refseq: NM_001015011
• Protein Refseq: NP_001015011
• UniProt ID: Q5BJ95