Recombinant Rat IL10 Protein

• Cat.No.: IL10-129R
• Product Overview: Recombinant Rat IL10 Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Description: Interleukin 10 (IL-10) is an anti-inflammatory cytokine produced by macrophages and type 2 T helper (Th2) cells. IL-10 inhibits the production of pro-inflammatory cytokines such as interferon gamma (IFN´), tumor necrosis factor alpha (TNFα), interleukin 2 (IL-2), interleukin 3 (IL-3), interleukin 4 (IL-4), and granulocyte-macrophage colony-stimulating factor (GM-CSF), made by macrophages and regulatory T cells. IL-10 also suppresses antigen presentation on antigen presenting cells, and enhances the survival, proliferation, and antibody production of B cells. Mouse IL-10 is not active on human cells.
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 18.8 kDa (161 aa)
• AA Sequence: MSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Il10 interleukin 10 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: IL10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X
• Gene ID: 25325
• mRNA Refseq: NM_012854
• Protein Refseq: NP_036986
• UniProt ID: P29456