Recombinant Rat Il10 protein

• Cat.No.: Il10-18R
• Product Overview: Recombinant Rat Il10 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 160
• Description: Factor involved in the inhibition of cytokine synthesis
• Form: Lyophilized from a 0.2μm filtered solution in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids.
• AA Sequence: SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
• Endotoxin: Less than 0.1 EU/µg of rRtIL-10 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il10
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X
• Gene ID: 25325
• mRNA Refseq: NM_012854
• Protein Refseq: NP_036986
• UniProt ID: P29456