Recombinant Rat Il10 protein
Cat.No. : | Il10-18R |
Product Overview : | Recombinant Rat Il10 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 160 |
Description : | Factor involved in the inhibition of cytokine synthesis |
Form : | Lyophilized from a 0.2μm filtered solution in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
AA Sequence : | SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
Endotoxin : | Less than 0.1 EU/µg of rRtIL-10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il10 |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X; |
Gene ID | 25325 |
mRNA Refseq | NM_012854 |
Protein Refseq | NP_036986 |
UniProt ID | P29456 |
◆ Recombinant Proteins | ||
il10-15Z | Recombinant Zebrafish il10 protein | +Inquiry |
Il10-328M | Active Recombinant Mouse Il10, Fc-tagged | +Inquiry |
Il10-082M | Active Recombinant Mouse Il10 Protein | +Inquiry |
IL10-2627H | Active Recombinant Human IL10 protein, His-tagged | +Inquiry |
Il10-040M | Recombinant Mouse interleukin 10 Protein, His&Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket