Recombinant Rat IFNG Protein
Cat.No. : | IFNG-117R |
Product Overview : | Recombinant Rat IFNG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Interferon gamma (IFN-γ) is a type II interferon that is critical during adaptive and innate immune responses to infection. IFN-γ is produced by T cells and natural killer cells following antigen-specific activation. IFN-γ binds IFN-γ receptors (IFN-γ R1 and IFN-γ R2), which are expressed on most immune cells, to activate the JAK-STAT pathway. IFN-γ-induced signaling increases the expression of class 1 major histocompatibility complex (MHC) molecules. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Noncovalently-linked homodimer, 15.6/31.2 kDa (135/270 aa) |
AA Sequence : | MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Ifng interferon gamma [ Rattus norvegicus (Norway rat) ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon gamma; IFN-gamma; IFNG2; |
Gene ID | 25712 |
mRNA Refseq | NM_138880 |
Protein Refseq | NP_620235 |
UniProt ID | P01581 |
◆ Recombinant Proteins | ||
IFNg-31H | Recombinant Human IFN gamma | +Inquiry |
IFNG-801D | Recombinant Dog IFNG protein, His & T7-tagged | +Inquiry |
IFNG-8665H | Recombinant Human IFNG protein, hFc-Flag-tagged | +Inquiry |
IFNG-94H | Recombinant Human Interferon Gamma | +Inquiry |
IFNG-1367H | Active Recombinant Human IFNG | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket