Recombinant Rat Hspb6 protein, His-tagged

• Cat.No.: Hspb6-644R
• Product Overview: Recombinant Rat Hspb6 protein(P97541)(1-162aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Rat
• Tag: His
• Protein length: 1-162a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.4 kDa
• AASequence: MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Hspb6 heat shock protein, alpha-crystallin-related, B6 [ Rattus norvegicus ]
• Official Symbol: Hspb6
• Synonyms: HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; heat shock 20-kDa protein; heat shock 20 kDa-like protein p20; p20; Hsp20
• Gene ID: 192245
• mRNA Refseq: NM_138887
• Protein Refseq: NP_620242