Recombinant Rat Gstp1 protein, His-tagged

• Cat.No.: Gstp1-3003R
• Product Overview: Recombinant Rat Gstp1 protein(P04906)(2-210aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 2-210aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.3 kDa
• AA Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Gstp1 glutathione S-transferase pi 1 [ Rattus norvegicus ]
• Official Symbol: Gstp1
• Synonyms: GSTP1; glutathione S-transferase pi 1; glutathione S-transferase P; GST 7-7; chain 7; GST class-pi; glutathione S-transferase pi 2; glutathione S-transferase, pi 2; glutathione-S-transferase, pi 1; Glutathione-S-transferase placental enzyme pi type; Glutathione-S-transferase, placental enzyme pi type; Gst3; Gstp; GST-P; Gstp2; MGC72668; MGC72669
• Gene ID: 24426
• mRNA Refseq: NM_012577
• Protein Refseq: NP_036709