Recombinant Rat Glp1r protein, His/SUMO-tagged

• Cat.No.: GLP1R-2565R
• Product Overview: Recombinant Rat Glp1r(22-463 aa) fused with His/SUMO tag at was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 22-463 aa
• Description: Glp1r played an important role in many functions.
• Form: Tris-based buffer,50% glycerol
• AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLYIIYTVGYALSFSALVIASAILVSFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLVFIRVICIVIAKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGFMVAVLYCFVNNEVQMEFRKSWERWRLERLNIQRDSSMKPLKCPTSSVSSGATVGSSVYAATCQNSCS
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.

Gene Information

• Gene Name: Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ]
• Official Symbol: Glp1r
• Synonyms: GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; Glip; RATGL1RCP
• Gene ID: 25051
• mRNA Refseq: NM_012728
• Protein Refseq: NP_036860
• UniProt ID: P32301
• Chromosome Location: 20p12
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Glucagon-type ligand receptors, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem
• Function: G-protein coupled peptide receptor activity; G-protein coupled peptide receptor activity; G-protein coupled receptor activity; glucagon receptor activity; peptide hormone binding; peptide receptor activity; receptor activity; signal transducer activity