Recombinant Rat GLP1R Protein (22-135 aa), His-tagged

• Cat.No.: GLP1R-2107R
• Product Overview: Recombinant Rat GLP1R Protein (22-135 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• ProteinLength: 22-135 aa
• Description: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.1 kDa
• AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ]
• Official Symbol: GLP1R
• Synonyms: GLP1R; GLP-1R; GLP-1-R; GLP-1 receptor; Glip; RATGL1RCP
• Gene ID: 25051
• mRNA Refseq: NM_012728
• Protein Refseq: NP_036860
• UniProt ID: P32301