Recombinant Human GLP1R Protein, His-tagged

Cat.No. : GLP1R-1228H
Product Overview : Recombinant Human GLP1R Protein (24-145aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-145 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 18.3 kDa
AA Sequence : RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWAS
SVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ]
Official Symbol GLP1R
Synonyms GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
Gene ID 2740
mRNA Refseq NM_002062
Protein Refseq NP_002053
MIM 138032
UniProt ID P43220

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLP1R Products

Required fields are marked with *

My Review for All GLP1R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon