Recombinant Rat Fabp3 protein, His-SUMO-tagged
Cat.No. : | Fabp3-2881R |
Product Overview : | Recombinant Rat Fabp3 protein(P07483)(2-133aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-133aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.6 kDa |
AA Sequence : | ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Fabp3 fatty acid binding protein 3, muscle and heart [ Rattus norvegicus ] |
Official Symbol | Fabp3 |
Synonyms | FABP3; fatty acid binding protein 3, muscle and heart; fatty acid-binding protein, heart; H-FABP; fatty acid-binding protein 3; heart fatty acid binding protein; Fatty acid binding protein 3 heart; fatty acid binding protein 3 heart; heart-type fatty acid-binding protein; |
Gene ID | 79131 |
mRNA Refseq | NM_024162 |
Protein Refseq | NP_077076 |
◆ Recombinant Proteins | ||
FABP3-3634H | Recombinant Human FABP3 Protein, GST-tagged | +Inquiry |
FABP3-3235H | Recombinant Human FABP3 Protein (Met1-Ala133), N-His tagged | +Inquiry |
FABP3-2927M | Recombinant Mouse FABP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP3-1183P | Recombinant Pig FABP3 protein, His&Myc-tagged | +Inquiry |
FABP3-363M | Recombinant Mouse FABP3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP3-6477HCL | Recombinant Human FABP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fabp3 Products
Required fields are marked with *
My Review for All Fabp3 Products
Required fields are marked with *
0
Inquiry Basket