Recombinant Rat Dio3 protein, His-tagged

Cat.No. : Dio3-4042R
Product Overview : Recombinant Rat Dio3 protein(P49897)(63-304aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Rat
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.5 kDa
Protein length : 63-304aa
AA Sequence : DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Dio3 deiodinase, iodothyronine, type III [ Rattus norvegicus ]
Official Symbol Dio3
Synonyms DIO3; deiodinase, iodothyronine, type III; type III iodothyronine deiodinase; type 3 DI; type-III 5-deiodinase; deiodinase, iodothyronine, type 3; 5DIII; DIOIII;
Gene ID 29475
mRNA Refseq NM_017210
Protein Refseq NP_058906

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Dio3 Products

Required fields are marked with *

My Review for All Dio3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon