Recombinant Rat Cxcl2 protein

• Cat.No.: Cxcl2-54R
• Product Overview: Recombinant Rat Cxcl2 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 73
• Description: Rat CXCL2 also named CINC-3, belongs to the CXC chemokine family. It is encoded by the gene CXCL2 and shares 90 % amino acid sequence with CXCL1/GROα. It is member of the intercrine alpha (chemokine C-X-C) subfamily of chemokines. This chemokine is expressed by cytokine-stimulated rat alveolar macrophages and fibroblasts. The functional receptor for CXCL2 has been identified as CXCR2. CXCL2 is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. Similar to other GRO proteins, CXCL2 is potent neutrophil attractants and activators. In addition, it is also active toward basophils. The amino acid sequence of rat CXCL2 is 88 % identical to murine CXCL2.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids.
• AA Sequence: VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
• Endotoxin: Less than 1 EU/μg of rRtCINC-3/CXCL2 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Cxcl2
• Official Symbol: Cxcl2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2
• Gene ID: 114105
• mRNA Refseq: NM_053647
• Protein Refseq: NP_446099
• UniProt ID: P30348