Recombinant Rat Cx3cl1 protein

Cat.No. : Cx3cl1-633R
Product Overview : Recombinant Rat Cx3cl1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 76
Description : CX3CL1 recently identified through bioinformatics is the only known member of the CX3C chemokine family and it is also commonly known under the names fractalkine (in humans) and neurotactin (in mice). Unlike other known chemokines, CX3CL1 is a type 1 membrane protein containing a chemokine domain tethered on a long mucinlike talk. The soluble form of CX3CL1 is chemotactic for T-cells and monocytes, but not for neutrophils. In addition, it may play a role in regulating leukocyte adhesion and migration processes at the endothelium. Recombinant Rat CX3CL1 contains 76 amino acids and it shares approximately 86 % and 83 % amino acid sequence homology with the murine and human protein.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2× PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 5.0-10 ng/ml.
Molecular Mass : Approximately 8.8 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Rat Fractalkine.
AA Sequence : QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG
Endotoxin : Less than 1 EU/µg of rRtFractalkine/CX3CL1 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cx3cl1
Official Symbol Cx3cl1
Synonyms CX3CL1; chemokine (C-X3-C motif) ligand 1; fractalkine; neurotactin; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D, 1; Cx3c; Scyd1;
Gene ID 89808
mRNA Refseq NM_134455
Protein Refseq NP_604450
UniProt ID O55145

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cx3cl1 Products

Required fields are marked with *

My Review for All Cx3cl1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon