Recombinant Rat Cspg4 protein, His-tagged

• Cat.No.: Cspg4-3544R
• Product Overview: Recombinant Rat Cspg4 protein(Q00657)(575-1044aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 575-1044aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GPEIFQAYDPDSACEGLTIQLLGVSASVPVEHRDQPGEPVTEFSCRDLEAGNIVYVHRGGPAQDLTFRVSDGMQASGPATLKVVAVRPAIQILHNTGLRLAQGSAAAILPANLSVETNAVGQDVSVLFRVTGTLQFGELQKQGAGGVEGTEWWDTLAFHQRDVEQGRVRYLSTDPQHHTQDTVEDLTLEVQVGQETLSNLSFPVTIQRATVWMLQLEPLHTQNPHQETLTSAHLEASLEEEGEGGPYPHIFHYELVQAPRRGNLLLQGTRLSDGQSFSQSDLQAGRVTYRATTRTSEAAEDSFRFRVTSPPHFSPLYTFPIHIGGDPNAPVLTNVLLMVPEGGEGVLSADHLFVKSLNSASYLYEVMEQPHHGSLAWRDPKGRATPVTSFTNEDLLHGRLVYQHDDSETIEDDIPFVATRQGEGSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRVFHVARGGQRLLTTD

Gene Information

• Gene Name: Cspg4 chondroitin sulfate proteoglycan 4 [ Rattus norvegicus ]
• Official Symbol: Cspg4
• Synonyms: CSPG4; chondroitin sulfate proteoglycan 4; HSN tumor-specific antigen; membrane-spanning proteoglycan NG2; chondroitin sulfate proteoglycan NG2; Ng2
• Gene ID: 81651
• mRNA Refseq: NM_031022
• Protein Refseq: NP_112284