Recombinant Rat Cpa1 protein, His&Myc-tagged
Cat.No. : | Cpa1-2719R |
Product Overview : | Recombinant Rat Cpa1 protein(P00731)(111-419aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 111-419aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cpa1 carboxypeptidase A1 (pancreatic) [ Rattus norvegicus ] |
Official Symbol | Cpa1 |
Synonyms | CPA1; carboxypeptidase A1 (pancreatic); carboxypeptidase A1; |
Gene ID | 24269 |
mRNA Refseq | NM_016998 |
Protein Refseq | NP_058694 |
◆ Recombinant Proteins | ||
CPA1-3176H | Active Recombinant Human CPA1 protein, His-tagged | +Inquiry |
CPA1-3303H | Recombinant Human CPA1 Protein, MYC/DDK-tagged | +Inquiry |
CPA1-1768H | Recombinant Human CPA1 Protein, GST-tagged | +Inquiry |
Cpa1-2719R | Recombinant Rat Cpa1 protein, His&Myc-tagged | +Inquiry |
CPA1-1561R | Recombinant Rat CPA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPA1-2171HCL | Recombinant Human CPA1 cell lysate | +Inquiry |
CPA1-2478MCL | Recombinant Mouse CPA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cpa1 Products
Required fields are marked with *
My Review for All Cpa1 Products
Required fields are marked with *
0
Inquiry Basket