Recombinant Rat CLEC12A Protein, His-tagged

Cat.No. : CLEC12A-356R
Product Overview : Recombinant Rat CLEC12A Protein(NP_001128188.1), fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : HEK293
Species : Rat
Tag : His
Form : Supplied as a 0.2 μm filtered solution in PBS, pH7.4.
Molecular Mass : ~26.2KDa, reducing conditions
AA Sequence : MHSSALLCCLVLLTGVRAETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQELSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFIKSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCDEEKYTMCEETASKVQVESVLSDLPEGSILHHHHHH
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.417mg/mL
Gene Name Clec12a C-type lectin domain family 12, member A [ Rattus norvegicus (Norway rat) ]
Official Symbol CLEC12A
Synonyms CLEC12A
Gene ID 680338
mRNA Refseq NM_001134716.1
Protein Refseq NP_001128188.1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC12A Products

Required fields are marked with *

My Review for All CLEC12A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon