Recombinant Rat CLEC12A Protein, His-tagged
Cat.No. : | CLEC12A-356R |
Product Overview : | Recombinant Rat CLEC12A Protein(NP_001128188.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Molecular Mass : | ~26.2KDa, reducing conditions |
AA Sequence : | MHSSALLCCLVLLTGVRAETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQELSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFIKSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCDEEKYTMCEETASKVQVESVLSDLPEGSILHHHHHH |
Purity : | >90%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.417mg/mL |
Gene Name | Clec12a C-type lectin domain family 12, member A [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CLEC12A |
Synonyms | CLEC12A |
Gene ID | 680338 |
mRNA Refseq | NM_001134716.1 |
Protein Refseq | NP_001128188.1 |
◆ Recombinant Proteins | ||
CLEC12A-1456H | Recombinant Human CLEC12A Protein, GST-tagged | +Inquiry |
CLEC12A-50H | Active Recombinant Human CLEC12A Protein (Thr67-Ala265), N-hFc tagged | +Inquiry |
CLEC12A-6910H | Recombinant Human CLEC12A protein(His75-Ala275), His-tagged | +Inquiry |
CLEC12A-2950H | Active Recombinant Human CLEC12A protein, Fc-tagged | +Inquiry |
CLEC12A-1908C | Recombinant Cynomolgus CLEC12A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC12A-1920HCL | Recombinant Human CLEC12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC12A Products
Required fields are marked with *
My Review for All CLEC12A Products
Required fields are marked with *
0
Inquiry Basket