Recombinant Rat CFD Protein (26-263 aa), His-tagged

• Cat.No.: CFD-2178R
• Product Overview: Recombinant Rat CFD Protein (26-263 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 26-263 aa
• Description: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.8 kDa
• AA Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Cfd complement factor D (adipsin) [ Rattus norvegicus ]
• Official Symbol: CFD
• Synonyms: CFD; complement factor D; adipsin; properdin factor D; Df; Adn; EVE
• Gene ID: 54249
• mRNA Refseq: NM_001077642
• Protein Refseq: NP_001071110
• UniProt ID: P32038