Recombinant Rat Cav1 protein, His&Myc-tagged

• Cat.No.: Cav1-2640R
• Product Overview: Recombinant Rat Cav1 protein(P41350)(2-178aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-178aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.9 kDa
• AA Sequence: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cav1 caveolin 1, caveolae protein [ Rattus norvegicus ]
• Official Symbol: Cav1
• Synonyms: CAV1; caveolin 1, caveolae protein; caveolin-1; caveolin, caveolae protein 1; caveolin caveolae protein 22 kDa; Cav; MGC187299
• Gene ID: 25404
• mRNA Refseq: NM_031556
• Protein Refseq: NP_113744