Recombinant Rat CAPRIN2 Protein (894-1028 aa), His-tagged

• Cat.No.: CAPRIN2-2529R
• Product Overview: Recombinant Rat CAPRIN2 Protein (894-1028 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Source: E. coli
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.2 kDa
• Protein length: 894-1028 aa
• AA Sequence: PQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Caprin2 caprin family member 2 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: CAPRIN2
• Synonyms: Caprin2; Adir; Rng140
• Gene ID: 686779
• UniProt ID: M0R6B1