Recombinant Rat Bcl2 Full Length Transmembrane protein, His-tagged

• Cat.No.: Bcl2-1213R
• Product Overview: Recombinant Rat Bcl2 protein(P49950)(1-236aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 1-236aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.1 kDa
• AA Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Bcl2 B-cell CLL/lymphoma 2 [ Rattus norvegicus ]
• Official Symbol: Bcl2
• Synonyms: BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; Bcl2-like protein; B-cell leukemia/lymphoma 2; B cell lymphoma 2 associated oncogene; Bcl-2
• Gene ID: 24224
• mRNA Refseq: NM_016993
• Protein Refseq: NP_058689