Recombinant Dog BCL2 protein, His-tagged

• Cat.No.: BCL2-5732D
• Product Overview: Recombinant Dog BCL2 protein(Q6R755)(1-236aa), fused with N-terminal His tag, was expressed in vitro E.coli expression system.

Specification

• Source: in vitro E.coli expression system
• Species: Dog
• Tag: N-His
• Protein length: 1-236aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.0 kDa
• AASequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: BCL2 B-cell CLL/lymphoma 2 [ Canis lupus familiaris ]
• Official Symbol: BCL2
• Synonyms: BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; BCL-2
• Gene ID: 403416
• mRNA Refseq: NM_001002949
• Protein Refseq: NP_001002949