Recombinant Rat Aif1 protein, His-SUMO-tagged

• Cat.No.: Aif1-2498R
• Product Overview: Recombinant Rat Aif1 protein(P55009)(2-147aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-147aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.7 kDa
• AA Sequence: SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Aif1 allograft inflammatory factor 1 [ Rattus norvegicus ]
• Official Symbol: Aif1
• Synonyms: AIF1; allograft inflammatory factor 1; protein BART-1; AIF-1; microglia response factor; balloon angioplasty responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; balloon angioplasty-responsive transcript 1; iba1; Bart1; mrf-1
• Gene ID: 29427
• mRNA Refseq: NM_017196
• Protein Refseq: NP_058892