Recombinant Rat Aif1 protein, His-SUMO-tagged

Cat.No. : Aif1-2498R
Product Overview : Recombinant Rat Aif1 protein(P55009)(2-147aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Rat
Tag : His&SUMO
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.7 kDa
Protein length : 2-147aa
AA Sequence : SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Aif1 allograft inflammatory factor 1 [ Rattus norvegicus ]
Official Symbol Aif1
Synonyms AIF1; allograft inflammatory factor 1; protein BART-1; AIF-1; microglia response factor; balloon angioplasty responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; balloon angioplasty-responsive transcript 1; iba1; Bart1; mrf-1;
Gene ID 29427
mRNA Refseq NM_017196
Protein Refseq NP_058892

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Aif1 Products

Required fields are marked with *

My Review for All Aif1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon