Recombinant Rat AIF1 Protein (2-147 aa), His-tagged

• Cat.No.: AIF1-1323R
• Product Overview: Recombinant Rat AIF1 Protein (2-147 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.

Specification

• Description: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).
• Source: Yeast
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.7 kDa
• Protein length: 2-147 aa
• AA Sequence: SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Aif1 allograft inflammatory factor 1 [ Rattus norvegicus ]
• Official Symbol: AIF1
• Synonyms: AIF1; AIF-1; iba1; Bart1; mrf-1
• Gene ID: 29427
• mRNA Refseq: NM_017196
• Protein Refseq: NP_058892
• UniProt ID: P55009