Recombinant Rat AIF1 Protein (2-147 aa), His-tagged

Cat.No. : AIF1-1323R
Product Overview : Recombinant Rat AIF1 Protein (2-147 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 2-147 aa
Description : Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.7 kDa
AA Sequence : SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Aif1 allograft inflammatory factor 1 [ Rattus norvegicus ]
Official Symbol AIF1
Synonyms AIF1; AIF-1; iba1; Bart1; mrf-1;
Gene ID 29427
mRNA Refseq NM_017196
Protein Refseq NP_058892
UniProt ID P55009

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AIF1 Products

Required fields are marked with *

My Review for All AIF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon