Recombinant Rat ACACA Protein (116-617 aa), His-tagged

Cat.No. : ACACA-1879R
Product Overview : Recombinant Rat ACACA Protein (116-617 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.
Source : E. coli
Species : Rat
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 59.8 kDa
Protein length : 116-617 aa
AA Sequence : VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Acaca acetyl-CoA carboxylase alpha [ Rattus norvegicus ]
Official Symbol ACACA
Synonyms ACACA; acetyl-CoA carboxylase alpha; ACC-alpha; ACC1; Acac;
Gene ID 60581
mRNA Refseq NM_022193
Protein Refseq NP_071529
UniProt ID P11497

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACACA Products

Required fields are marked with *

My Review for All ACACA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon