Recombinant Human ACACA protein, GST-tagged
Cat.No. : | ACACA-127H |
Product Overview : | Recombinant Human ACACA protein(NP_942131)(2260-2383 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2260-2383 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ACACA acetyl-CoA carboxylase alpha [ Homo sapiens ] |
Official Symbol | ACACA |
Synonyms | ACACA; acetyl-CoA carboxylase alpha; ACAC, ACC, acetyl Coenzyme A carboxylase alpha; acetyl-CoA carboxylase 1; ACC1; acetyl CoA carboxylase 1; ACC-alpha; acetyl-Coenzyme A carboxylase alpha; ACC; ACAC; ACCA; ACACAD; |
Gene ID | 31 |
mRNA Refseq | NM_198834 |
Protein Refseq | NP_942131 |
MIM | 200350 |
UniProt ID | Q13085 |
◆ Recombinant Proteins | ||
ACACA-7054C | Recombinant Chicken ACACA | +Inquiry |
acaca-17Z | Recombinant Zebrafish acaca Protein, His&GST-tagged | +Inquiry |
ACACA-1848H | Recombinant Human ACACA, His-tagged | +Inquiry |
ACACA-126H | Recombinant Human ACACA Protein, GST-Tagged | +Inquiry |
ACACA-8261Z | Recombinant Zebrafish ACACA | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACACA Products
Required fields are marked with *
My Review for All ACACA Products
Required fields are marked with *
0
Inquiry Basket