Recombinant Human ACACA protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Protein length :	2260-2383 aa
AA Sequence :	LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Name	ACACA acetyl-CoA carboxylase alpha [ Homo sapiens ]
Official Symbol	ACACA
Synonyms	ACACA; acetyl-CoA carboxylase alpha; ACAC, ACC, acetyl Coenzyme A carboxylase alpha; acetyl-CoA carboxylase 1; ACC1; acetyl CoA carboxylase 1; ACC-alpha; acetyl-Coenzyme A carboxylase alpha; ACC; ACAC; ACCA; ACACAD;
Gene ID	31
mRNA Refseq	NM_198834
Protein Refseq	NP_942131
MIM	200350
UniProt ID	Q13085