Recombinant Rainbow trout IL10 protein, His&Myc-tagged
Cat.No. : | IL10-2322R |
Product Overview : | Recombinant Rainbow trout IL10 protein(Q6L8N7)(24-184aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rainbow trout |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 24-184aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RRVPCSDRCCSFVEGFPVRLKELRTAFSTIRDYYEANDELETSLLDEGILHHLKSPVGCHAMDSILKFYLDTVLPTAMNNRTQNNNDFKSPIDSIGNIFHELKKEIVQCRNYFSCKKPFDINEFISSYEKMQDKGLYKAMGELDLLFNYIEEYLVSKRRKH |
◆ Recombinant Proteins | ||
IL10-262I | Active Recombinant Human IL10 Protein | +Inquiry |
Il10-17M | Recombinant Mouse Il10 protein | +Inquiry |
Il10-484R | Recombinant Rat Il10 protein, His-tagged | +Inquiry |
IL10-174H | Active Recombinant Human IL10 Protein (Ser19-Asn178), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL10-513R | Recombinant Rabbit IL10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket