Recombinant Mouse Il10 protein

• Cat.No.: Il10-17M
• Product Overview: Recombinant Mouse Il10 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 160
• Description: Interleukin-10 (IL-10) is encoded by the IL10 gene and expressed in monocytes and Type 2 T helper cells (Th2). The biological activities of IL-10 are mediated by the IL-10 receptor complex, which is composed of the ligand-binding IL-10 Rα/R1 and the accessory IL-10 Rβ/R2 subunits. IL-10 is capable of inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by T helper cells. IL-10 is classified as a class 2 cytokine which consist of IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26, several interferons and interferon-like molecules. Mature murine IL-10 shares 70 %-77 % amino acid sequence identity with human, bovine, porcine IL-10, but murine IL-10 does not act on human cells.
• Form: Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids.
• AA Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
• Endotoxin: Less than 1 EU/µg of rMuIL-10 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il10
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10
• Gene ID: 16153
• mRNA Refseq: NM_010548
• Protein Refseq: NP_034678
• UniProt ID: P18893