Recombinant Rabbit VEGFA protein, His-tagged

Cat.No. : VEGFA-3755R
Product Overview : Recombinant Rabbit VEGFA protein(XP_002714743.1)(51-511aa), fused to N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : Yeast
Tag : His
Protein Length : 51-511aa
Form : Tris-based buffer,50% glycerol.
Molecular Mass : 51.7kDa
AA Sequence : YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name VEGFA vascular endothelial growth factor A [ Oryctolagus cuniculus ]
Official Symbol VEGFA
Synonyms VEGFA; vascular endothelial growth factor A; VEGF
Gene ID 100008899
Protein Refseq XP_002714743.1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon