Recombinant Rabbit HINT1 Protein, His/MYC-tagged

• Cat.No.: HINT1-1238R
• Product Overview: Recombinant Rabbit HINT1 Protein (2-126aa) was expressed in mammalian cells with N-terminal 10xHis-tag and C-terminal Myc-tag.

Specification

• Species: Rabbit
• Source: HEK293
• Tag: His&Myc
• ProteinLength: 2-126 a.a.
• Form: Tris-based buffer, 50% glycerol.
• AA Sequence: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADE
  SLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: HINT1 histidine triad nucleotide binding protein 1 [ Oryctolagus cuniculus (rabbit) ]
• Official Symbol: HINT1
• Synonyms: HINT; HINT1; histidine triad nucleotide-binding protein 1; P13.7; adenosine 5'-monophosphoramidase
• Gene ID: 100009302
• mRNA Refseq: NM_001082623.1
• Protein Refseq: NP_001076092.1
• UniProt ID: P80912