Recombinant Rabbit APOE Protein, His/MYC-tagged
Cat.No. : | APOE-1127R |
Product Overview : | Recombinant Rabbit APOE Protein (20-311aa) was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 20-311 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | APOE apolipoprotein E [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | APOE |
Synonyms | APOE; apolipoprotein E; apo-E |
Gene ID | 100009337 |
mRNA Refseq | NM_001082643.1 |
Protein Refseq | NP_001076112.1 |
UniProt ID | P18287 |
◆ Recombinant Proteins | ||
Apoa4-2532M | Recombinant Mouse Apoa4 protein, GST-tagged | +Inquiry |
EDA2R-76C | Recombinant Cynomolgus EDA2R, Fc tagged | +Inquiry |
HDAC4-1045H | Recombinant Human HDAC4 Protein (T648-T1057), His tagged | +Inquiry |
CHST5-1677M | Recombinant Mouse CHST5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHAX-4076R | Recombinant Rat PHAX Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
VCL-899T | Native Turkey VCL Protein | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFKB1-3850HCL | Recombinant Human NFKB1 293 Cell Lysate | +Inquiry |
OAZ1-450HCL | Recombinant Human OAZ1 lysate | +Inquiry |
CYC1-7136HCL | Recombinant Human CYC1 293 Cell Lysate | +Inquiry |
CAMKK1-7873HCL | Recombinant Human CAMKK1 293 Cell Lysate | +Inquiry |
LILRB1-774HCL | Recombinant Human LILRB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
0
Inquiry Basket