Species :	R.japonica
Source :	E.coli
Tag :	His&SUMO
ProteinLength :	20-159 a.a.
Form :	Tris-based buffer, 50% glycerol.
Molecular Mass :	30.5 kDa
AA Sequence :	CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQR ALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

◆ Recombinant Proteins
IL2-635C	Recombinant Cattle IL2 protein, His & T7-tagged	+Inquiry
HBG1-30144H	Recombinant Human HBG1 protein, GST-tagged	+Inquiry
SGR-RS31465-869S	Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS31465 protein, His-tagged	+Inquiry
RFL18539CF	Recombinant Full Length Cambarellus Shufeldtii Rhodopsin(Rho) Protein, His-Tagged	+Inquiry
Dpy30-2648M	Recombinant Mouse Dpy30 Protein, Myc/DDK-tagged	+Inquiry
See All IL2 Recombinant Proteins

◆ Native Proteins
Collagen-60H	Native Human Collagen Type II	+Inquiry
ALPI-5B	Active Native Bovine Alkaline Phosphatase	+Inquiry
LDH3-124H	Active Native Human Lactate Dehydrogenase 3	+Inquiry
IgA-243C	Native Cat Immunoglobulin A	+Inquiry
LYZ-139C	Native Chicken lysozyme	+Inquiry
See All Collagen Native Proteins

◆ Cell & Tissue Lysates
LRCH1-392HCL	Recombinant Human LRCH1 lysate	+Inquiry
WDR91-328HCL	Recombinant Human WDR91 293 Cell Lysate	+Inquiry
PRTFDC1-2799HCL	Recombinant Human PRTFDC1 293 Cell Lysate	+Inquiry
CSAG1-1615HCL	Recombinant Human CSAG1 cell lysate	+Inquiry
JUN-5095HCL	Recombinant Human JUN 293 Cell Lysate	+Inquiry
See All LRCH1 Cell & Tissue Lysates