Recombinant Pyrococcus Furiosus ALBA Protein (1-93 aa), His-SUMO-tagged

• Cat.No.: ALBA-1917P
• Product Overview: Recombinant Pyrococcus Furiosus (strain ATCC 43587/DSM 3638/JCM 8422/Vc1) ALBA Protein (1-93 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Pyrococcus Furiosus
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-93 aa
• Description: Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.4 kDa
• AA Sequence: MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: albA
• UniProt ID: Q8TZV1