Recombinant Pseudomonas Aeruginosa OPRP Protein (30-440 aa), His-SUMO-tagged
| Cat.No. : | OPRP-1883P |
| Product Overview : | Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/PAO1/1C/PRS 101/LMG 12228) OPRP Protein (30-440 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pseudomonas Aeruginosa |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 30-440 aa |
| Description : | Anion specific, the binding site has higher affinity for phosphate than chloride ions. Porin O has a higher affinity for polyphosphates (tripolyphosphate and pyrophosphate) while porin P has a higher affinity for orthophosphate. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 61.2 kDa |
| AA Sequence : | GTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYGRFDGYYTNNGNTADAAYFRRAYLEFGGTAYRDWKYQINYDLSRNVGNDSAGYFDEASVTYTGFNPVNLKFGRFYTDFGLEKATSSKWVTALERNLTYDIADWVNDNVGTGIQASSVVGGMAFLSGSVFSENNNDTDGDSVKRYNLRGVFAPLHEPGNVVHLGLQYAYRDLEDSAVDTRIRPRMGMRGVSTNGGNDAGSNGNRGLFGGSSAVEGLWKDDSVWGLEGAWALGAFSAQAEYLRRTVKAERDREDLKASGYYAQLAYTLTGEPRLYKLDGAKFDTIKPENKEIGAWELFYRYDSIKVEDDNIVVDSATREVGDAKGKTHTLGVNWYANEAVKVSANYVKAKTDKISNANGDDSGDGLVMRLQYVF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | oprP phosphate-specific outer membrane porin OprP [ Pseudomonas aeruginosa PAO1 ] |
| Official Symbol | OPRP |
| Synonyms | oprP; Outer membrane protein D1; |
| Gene ID | 882442 |
| Protein Refseq | NP_251969 |
| UniProt ID | P05695 |
| ◆ Recombinant Proteins | ||
| OPRP-1883P | Recombinant Pseudomonas Aeruginosa OPRP Protein (30-440 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPRP Products
Required fields are marked with *
My Review for All OPRP Products
Required fields are marked with *
0
Inquiry Basket
