Recombinant Pseudomonas Aeruginosa LASA Protein (237-418 aa), His-SUMO-tagged

• Cat.No.: LASA-2104P
• Product Overview: Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/PAO1/1C/PRS 101/LMG 12228) LASA Protein (237-418 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Pseudomonas Aeruginosa
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 237-418 aa
• Description: Involved in proteolysis and elastolysis (degradation of the host protein elastin). Has staphylolytic activity (degrades pentaglycine cross-links in cell wall peptidogylcan), preferring Gly-Gly-|-X substrates where X is Ala or Gly (PubMed:11179971). Enhances the elastolytic but not proteolytic activity of elastase (lasB) and elastolytic activity of other proteases (PubMed:2110137). Degradation of host elastin is likely to contribute to the pathogenicity of P.aeruginosa. While either His-317 or His-356 can abstract a proton in the hydrolysis reaction, the same residue performs both functions in a given catalytic cycle, with the other stabilizing the catalytic intermediate.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 36.0 kDa
• AA Sequence: APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: lasA protease LasA [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: LASA
• Synonyms: lasA; Staphylolytic protease
• Gene ID: 878260
• Protein Refseq: NP_250562
• UniProt ID: P14789