Recombinant Pseudomonas Aeruginosa LASA Protein (237-418 aa), His-SUMO-tagged
| Cat.No. : | LASA-2104P |
| Product Overview : | Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/PAO1/1C/PRS 101/LMG 12228) LASA Protein (237-418 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pseudomonas Aeruginosa |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 237-418 aa |
| Description : | Involved in proteolysis and elastolysis (degradation of the host protein elastin). Has staphylolytic activity (degrades pentaglycine cross-links in cell wall peptidogylcan), preferring Gly-Gly-|-X substrates where X is Ala or Gly (PubMed:11179971). Enhances the elastolytic but not proteolytic activity of elastase (lasB) and elastolytic activity of other proteases (PubMed:2110137). Degradation of host elastin is likely to contribute to the pathogenicity of P.aeruginosa. While either His-317 or His-356 can abstract a proton in the hydrolysis reaction, the same residue performs both functions in a given catalytic cycle, with the other stabilizing the catalytic intermediate. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 36.0 kDa |
| AA Sequence : | APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | lasA protease LasA [ Pseudomonas aeruginosa PAO1 ] |
| Official Symbol | LASA |
| Synonyms | lasA; Staphylolytic protease; |
| Gene ID | 878260 |
| Protein Refseq | NP_250562 |
| UniProt ID | P14789 |
| ◆ Recombinant Proteins | ||
| LASA-2104P | Recombinant Pseudomonas Aeruginosa LASA Protein (237-418 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LASA Products
Required fields are marked with *
My Review for All LASA Products
Required fields are marked with *
0
Inquiry Basket
