Recombinant Pseudomona PcrV Protein, His tagged

• Cat.No.: PcrV-12P
• Product Overview: Recombinant Pseudomona PcrV Protein with His tag was expressed in E. coli.

Specification

• Species: Pseudomona
• Source: E.coli
• Tag: His
• Description: PcrV is located at the needle end of T3SS and is involved in the translocation of toxins into host cells. PcrV is a well-conserved protein, with 98% homology among different isolates.
• Molecular Mass: The protein has a calculated MW of 34 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.7 mg/mL by BCA
• Storage Buffer: Sterile 50 mM Tris, pH 8.0, 100 mM NaCl

Gene Information

• Official Symbol: PcrV
• Synonyms: PcrV