Recombinant Pongo Pygmaeus DEFB126 Protein (21-63 aa), GST-tagged
| Cat.No. : | DEFB126-1379P |
| Product Overview : | Recombinant Pongo Pygmaeus (Bornean orangutan) DEFB126 Protein (21-63 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Has antibacterial activity. Curated |
| Source : | Yeast |
| Species : | Pongo Pygmaeus |
| Tag : | GST |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.9 kDa |
| Protein length : | 21-63 aa |
| AA Sequence : | SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | DEFB126; Defensin; beta 126; |
| UniProt ID | A4H244 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB126 Products
Required fields are marked with *
My Review for All DEFB126 Products
Required fields are marked with *
0
Inquiry Basket
