Recombinant Pongo Pygmaeus DEFB126 Protein (21-63 aa), GST-tagged

Cat.No. : DEFB126-1379P
Product Overview : Recombinant Pongo Pygmaeus (Bornean orangutan) DEFB126 Protein (21-63 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pongo Pygmaeus
Source : Yeast
Tag : GST
Protein Length : 21-63 aa
Description : Has antibacterial activity. Curated
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.9 kDa
AA Sequence : SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms DEFB126; Defensin; beta 126;
UniProt ID A4H244

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFB126 Products

Required fields are marked with *

My Review for All DEFB126 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon