Recombinant Plasmodium Falciparum MSA2 Protein (109-246 aa), His-tagged

• Cat.No.: MSA2-1602P
• Product Overview: Recombinant Plasmodium Falciparum (isolate 3D7) MSA2 Protein (109-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Plasmodium Falciparum
• Source: Yeast
• Tag: His
• Protein Length: 109-246 aa
• Description: May play a role in the merozoite attachment to the erythrocyte.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.7 kDa
• AA Sequence: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: MSA2; 45 kDa merozoite surface antigen
• UniProt ID: P50498