Recombinant Pig IL1RN protein

• Cat.No.: IL1RN-89P
• Product Overview: Recombinant Pig IL1RN protein was expressed in Escherichia coli.

Specification

• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Source: E.coli
• Species: Pig
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4, 1 mM DTT.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α-dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg in the presence of 75 pg/ml rPoIL-1α.
• Molecular Mass: Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
• Protein length: 152
• AA Sequence: HPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNTKLEEKIDVVPVEPHFVFLGIHGGKLCLSCVKSGDEMKLQLDAVNITDLRKNSEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADQPVGLTNTPKAAVKVTKFYFQQDQ
• Endotoxin: Less than 0.1 EU/µg of rPoIL-1RA as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: IL1RN
• Official Symbol: IL1RN
• Synonyms: IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; IRAP; IL-1RN; IL-1ra; IL1 inhibitor; IRAP1
• Gene ID: 397499
• mRNA Refseq: NM_214262
• Protein Refseq: NP_999427
• UniProt ID: Q29056