Recombinant Pig HSP90AA1 Protein, His-tagged

• Cat.No.: HSP90AA1-1246P
• Product Overview: Recombinant Pig HSP90AA1 Protein (222-367aa) was expressed in Baculovirus with N-terminal His-tag.

Specification

• Source: Insect cell
• Species: Pig
• Tag: His
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 19.7 kDa
• AA Sequence: VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEEL
  NKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
  IKLYVR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 222-367 a.a.

Gene Information

• Gene Name: HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Sus scrofa (pig) ]
• Official Symbol: HSP90AA1
• Synonyms: HSP90; Hspca; HSP90AA1; heat shock protein 90 alpha family class A member 1; 90-kDa heat shock protein; heat shock protein HSP 90-alpha
• Gene ID: 397028
• mRNA Refseq: NM_213973.2
• Protein Refseq: NP_999138.1
• UniProt ID: O02705