Recombinant Human HSP90AA1, His-tagged

Cat.No. : HSP90AA1-27845TH
Product Overview : Recombinant fragment, corresponding to amino acids 577-732 of Human Hsp90 alpha with N terminal His tag; MWt 18kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 577-732 a.a.
Description : HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219) (Chen et al.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 103 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKA QALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADK NDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMI KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEE VD
Sequence Similarities : Belongs to the heat shock protein 90 family.
Gene Name HSP90AA1 heat shock protein 90kDa alpha (cytosolic), class A member 1 [ Homo sapiens ]
Official Symbol HSP90AA1
Synonyms HSP90AA1; heat shock protein 90kDa alpha (cytosolic), class A member 1; heat shock 90kD protein 1, alpha , heat shock 90kDa protein 1, alpha , HSPC1, HSPCA; heat shock protein HSP 90-alpha; FLJ31884; Hsp89; Hsp90; HSP90N;
Gene ID 3320
mRNA Refseq NM_001017963
Protein Refseq NP_001017963
MIM 140571
Uniprot ID P07900
Chromosome Location 14q32.33
Pathway Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Axon guidance, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem;
Function ATP binding; ATP binding; ATPase activity; TPR domain binding; TPR domain binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSP90AA1 Products

Required fields are marked with *

My Review for All HSP90AA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon