Recombinant Pig F12 Protein (20-371 aa), His-tagged
Cat.No. : | F12-2040P |
Product Overview : | Recombinant Pig F12 Protein (20-371 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-371 aa |
Description : | Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 41.8 kDa |
AA Sequence : | IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | F12 coagulation factor XII (Hageman factor) [ Sus scrofa ] |
Official Symbol | F12 |
Synonyms | F12; coagulation factor XII; HAF; factor XII; hageman factor; FXII; |
Gene ID | 397474 |
mRNA Refseq | NM_214242 |
Protein Refseq | NP_999407 |
UniProt ID | O97507 |
◆ Recombinant Proteins | ||
F12-3606H | Recombinant Human F12 Protein, GST-tagged | +Inquiry |
F12-764H | Recombinant Human F12 protein, His-tagged | +Inquiry |
F12-3289R | Recombinant Rat F12 protein, His-GST-tagged | +Inquiry |
F12-12617H | Recombinant Human F12 protein, His-tagged | +Inquiry |
F12-4483HF | Recombinant Full Length Human F12 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
◆ Cell & Tissue Lysates | ||
F12-2115HCL | Recombinant Human F12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F12 Products
Required fields are marked with *
My Review for All F12 Products
Required fields are marked with *
0
Inquiry Basket