Recombinant Human F12 protein, His-tagged

• Cat.No.: F12-764H
• Product Overview: Recombinant Human F12 protein(P00748)(20-372aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 20-372aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.3 kDa
• AASequence: IPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQPWASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQAAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: F12 coagulation factor XII (Hageman factor) [ Homo sapiens ]
• Official Symbol: F12
• Synonyms: F12; coagulation factor XII (Hageman factor); coagulation factor XII; Hageman factor; beta-factor XIIa part 1; beta-factor XIIa part 2; coagulation factor XIIa heavy chain; coagulation factor XIIa light chain; HAF; HAE3; HAEX
• Gene ID: 2161
• mRNA Refseq: NM_000505
• Protein Refseq: NP_000496
• MIM: 610619
• UniProt ID: P00748