Recombinant Pig CASP1 protein, His&Myc-tagged
Cat.No. : | CASP1-473P |
Product Overview : | Recombinant Pig CASP1 protein(Q9N2I1)(120-297aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 120-297a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NPVKPASSEPRGSLKLCPPDIAQRLWKEKSAEIYPIMGKSIRTRLALIICNTEFENLPRRDGADVDIRDMKILLEDLGYSVDVRENLTASDMAIELKAFAARPEHKSSDSTFLVLMSHGIQAGICGKKYSEEVPDVLEVNTVFQILNTLNCPSLKDKPKVIIIQACRGEKQGVVWIKD |
Gene Name | CASP1 caspase 1, apoptosis-related cysteine peptidase [ Sus scrofa ] |
Official Symbol | CASP1 |
Synonyms | CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase-1; ICE; p45; CASP-1; IL-1BC; IL-1 beta-converting enzyme; interleukin-1 beta convertase; interleukin-1 beta converting enzyme; interleukin-1 beta-converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); |
Gene ID | 397319 |
mRNA Refseq | NM_214162 |
Protein Refseq | NP_999327 |
◆ Recombinant Proteins | ||
CASP1-2921HF | Recombinant Full Length Human CASP1 Protein, GST-tagged | +Inquiry |
CASP1-473P | Recombinant Pig CASP1 protein, His&Myc-tagged | +Inquiry |
CASP1-1213H | Recombinant Human CASP1 Protein (Asn120-Asp297), N-His tagged | +Inquiry |
Casp1-7151M | Recombinant Mouse Casp1 protein, His-tagged | +Inquiry |
CASP1-1266H | Recombinant Human CASP1 Protein (N120-D297, A317-H404), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *
0
Inquiry Basket