Recombinant Pig CASP1 protein, His&Myc-tagged

• Cat.No.: CASP1-473P
• Product Overview: Recombinant Pig CASP1 protein(Q9N2I1)(120-297aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Pig
• Source: E.coli
• Tag: His&Myc
• Protein Length: 120-297a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: NPVKPASSEPRGSLKLCPPDIAQRLWKEKSAEIYPIMGKSIRTRLALIICNTEFENLPRRDGADVDIRDMKILLEDLGYSVDVRENLTASDMAIELKAFAARPEHKSSDSTFLVLMSHGIQAGICGKKYSEEVPDVLEVNTVFQILNTLNCPSLKDKPKVIIIQACRGEKQGVVWIKD

Gene Information

• Gene Name: CASP1 caspase 1, apoptosis-related cysteine peptidase [ Sus scrofa ]
• Official Symbol: CASP1
• Synonyms: CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase-1; ICE; p45; CASP-1; IL-1BC; IL-1 beta-converting enzyme; interleukin-1 beta convertase; interleukin-1 beta converting enzyme; interleukin-1 beta-converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
• Gene ID: 397319
• mRNA Refseq: NM_214162
• Protein Refseq: NP_999327