Recombinant Pig AVPR2 Protein (292-370 aa), His-SUMO-tagged
| Cat.No. : | AVPR2-2048P |
| Product Overview : | Recombinant Pig AVPR2 Protein (292-370 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity). |
| Source : | E. coli |
| Species : | Pig |
| Tag : | His&SUMO |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.7 kDa |
| Protein length : | 292-370 aa |
| AA Sequence : | WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | AVPR2 arginine vasopressin receptor 2 [ Sus scrofa ] |
| Official Symbol | AVPR2 |
| Synonyms | AVPR2; 2R; AVPR V2; antidiuretic hormone receptor; |
| Gene ID | 397462 |
| mRNA Refseq | NM_214232 |
| Protein Refseq | NP_999397 |
| UniProt ID | P32307 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AVPR2 Products
Required fields are marked with *
My Review for All AVPR2 Products
Required fields are marked with *
0
Inquiry Basket
