Recombinant Pig AVPR2 Protein (292-370 aa), His-SUMO-tagged

Cat.No. : AVPR2-2048P
Product Overview : Recombinant Pig AVPR2 Protein (292-370 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His&SUMO
Protein Length : 292-370 aa
Description : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.7 kDa
AA Sequence : WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name AVPR2 arginine vasopressin receptor 2 [ Sus scrofa ]
Official Symbol AVPR2
Synonyms AVPR2; 2R; AVPR V2; antidiuretic hormone receptor;
Gene ID 397462
mRNA Refseq NM_214232
Protein Refseq NP_999397
UniProt ID P32307

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AVPR2 Products

Required fields are marked with *

My Review for All AVPR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon