Recombinant Full Length Rat Vasopressin V2 Receptor(Avpr2) Protein, His-Tagged
Cat.No. : | RFL31288RF |
Product Overview : | Recombinant Full Length Rat Vasopressin V2 receptor(Avpr2) Protein (Q00788) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT ASSSLMKDTPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Avpr2 |
Synonyms | Avpr2; Vasopressin V2 receptor; V2R; AVPR V2; Antidiuretic hormone receptor; Renal-type arginine vasopressin receptor |
UniProt ID | Q00788 |
◆ Recombinant Proteins | ||
RFL11287CF | Recombinant Full Length Dog Vasopressin V2 Receptor(Avpr2) Protein, His-Tagged | +Inquiry |
AVPR2-1052HFL | Recombinant Human AVPR2 protein, His&Flag-tagged | +Inquiry |
RFL801SF | Recombinant Full Length Pig Vasopressin V2 Receptor(Avpr2) Protein, His-Tagged | +Inquiry |
AVPR2-3126C | Recombinant Chicken AVPR2 | +Inquiry |
AVPR2-564R | Recombinant Rat AVPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AVPR2-8557HCL | Recombinant Human AVPR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Avpr2 Products
Required fields are marked with *
My Review for All Avpr2 Products
Required fields are marked with *
0
Inquiry Basket