Recombinant Phleum pratense Pollen allergen Phl p 5b Protein, His-SUMO-tagged
Cat.No. : | Phlp5b-1334P |
Product Overview : | Recombinant Phleum pratense Pollen allergen Phl p 5b Protein (20-284aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phleum pratense |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 20-284 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAP GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIID KIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKY AVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Pollen allergen Phl p 5b |
Official Symbol | Pollen allergen Phl p 5b |
Synonyms | Pollen allergen Phl p 5b; Allergen Phl p Vb; Phl p 5b; Phlp5b; Allergen |
UniProt ID | Q40963 |
◆ Native Proteins | ||
RBP-246H | Native Human Retinol Binding Protein | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-847P | Pig Pancreas Membrane Lysate, Total Protein | +Inquiry |
FAM96A-6338HCL | Recombinant Human FAM96A 293 Cell Lysate | +Inquiry |
CDKN2AIP-7615HCL | Recombinant Human CDKN2AIP 293 Cell Lysate | +Inquiry |
CLDN17-7467HCL | Recombinant Human CLDN17 293 Cell Lysate | +Inquiry |
Jejunum-250H | Human Jejunum Diabetic Disease Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Phlp5b Products
Required fields are marked with *
My Review for All Phlp5b Products
Required fields are marked with *
0
Inquiry Basket