Recombinant Paraphysa scrofa Kappa-theraphotoxin-Ps1b, His-KSI-tagged
Cat.No. : | Ps1b-78P |
Product Overview : | Recombinant Paraphysa scrofa Ps1b protein(P61231)(1-31aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paraphysa scrofa |
Source : | E.coli |
Tag : | N-His-KSI |
ProteinLength : | 1-31aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.3 kDa |
AASequence : | YCQKWMWTCDEERKCCEGLVCRLWCKRIINM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
IL5RA-241I | Active Recombinant Human IL5RA Protein | +Inquiry |
HDAC6-401H | Active Recombinant Human Histone Deacetylase 6, His-tagged | +Inquiry |
Epn1-962M | Recombinant Mouse Epn1 Protein, MYC/DDK-tagged | +Inquiry |
CD4-1561R | Recombinant Rabbit CD4 protein, His & GST-tagged | +Inquiry |
CUL5-0332H | Recombinant Human CUL5 Protein (A2-A780), His/Strep tagged | +Inquiry |
◆ Native Proteins | ||
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBPL2-1208HCL | Recombinant Human TBPL2 293 Cell Lysate | +Inquiry |
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
Spinal cord-460H | Human Spinal cord Lupus Lysate | +Inquiry |
MAP2K3-4510HCL | Recombinant Human MAP2K3 293 Cell Lysate | +Inquiry |
CDC73-7645HCL | Recombinant Human CDC73 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ps1b Products
Required fields are marked with *
My Review for All Ps1b Products
Required fields are marked with *
0
Inquiry Basket